MDM2 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A23388-5UL
20 ul
£164.00
A23388-20UL
100 ul
£342.00
A23388-100UL
500 ul
£1532.00
A23388-500UL
1000 ul
£2704.00
A23388-1000UL
About this Product
- SKU:
- A23388
- Additional Names:
- ACTFS|hdm2|HDMX|LSKB|MDM2
- Application:
- ELISA, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- This gene encodes a nuclear-localized E3 ubiquitin ligase. The encoded protein can promote tumor formation by targeting tumor suppressor proteins, such as p53, for proteasomal degradation. This gene is itself transcriptionally-regulated by p53. Overexpression or amplification of this locus is detected in a variety of different cancers. There is a pseudogene for this gene on chromosome 2. Alternative splicing results in a multitude of transcript variants, many of which may be expressed only in tumor cells.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 90 kDa (MDM2-FL)/60 kDa (MDM2-A)
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- TMIYRNLVVVNQQESSDSGTSVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDELSGERQRKRHKSDSISLSFDESLALC
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A23388
