ABflo[R] 647 Rabbit anti-Mouse CD59a monoclonal antibody
Product Sizes
10 tests
£ POA
A23362-10TESTS
100 tests
£259.00
A23362-100TESTS
200 tests
£390.00
A23362-200TESTS
500 tests
£592.00
A23362-500TESTS
About this Product
- SKU:
- A23362
- Additional Names:
- Cd59|MAC-IP|MACIF
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 647
- Extra Details:
- Predicted to enable complement binding activity. Involved in several processes, including negative regulation of angiogenesis; negative regulation of fibroblast growth factor production; and negative regulation of vascular endothelial growth factor receptor signaling pathway. Acts upstream of or within negative regulation of activation of membrane attack complex. Located in external side of plasma membrane. Is expressed in several structures, including Meckel's cartilage; nervous system; neural retina; skeleton; and testis. Human ortholog(s) of this gene implicated in colorectal carcinoma and ovarian cancer. Orthologous to human CD59 (CD59 molecule (CD59 blood group)).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 14kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- LTCYHCFQPVVSSCNMNSTCSPDQDSCLYAVAGMQVYQRCWKQSDCHGEIIMDQLEETKLKFRCCQFNLCNKS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A23362


