NSD3/WHSC1L1 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A2317-20UL
100 ul
£336.00
A2317-100UL
500 ul
£1258.00
A2317-500UL
1000 ul
£2228.00
A2317-1000UL
About this Product
- SKU:
- A2317
- Additional Names:
- KMT3F|KMT3G|NSD3/WHSC1L1|pp14328|WHISTLE|WHSC1L1
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- This gene is related to the Wolf-Hirschhorn syndrome candidate-1 gene and encodes a protein with PWWP (proline-tryptophan-tryptophan-proline) domains. This protein methylates histone H3 at lysine residues 4 and 27, which represses gene transcription. Two alternatively spliced variants have been described.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 85kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Sequence:
- PEQTNAGEVASSLSSTEIRRHSQRRHTSAEEEEPPPVKIAWKTAAARKSLPASITMHKGSLDLQKCNMSPVVKIEQVFALQNATGDGKFIDQFVYSTKGIGNKTEISVRGQDRLIISTPNQRNEKPTQSVSSPEATSGSTGSVEKKQQRRSIRTRSESEKS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A2317
