RYR1 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A23056-20UL
100 ul
£336.00
A23056-100UL
500 ul
£1258.00
A23056-500UL
1000 ul
£2228.00
A23056-1000UL
About this Product
- SKU:
- A23056
- Additional Names:
- CCO|CMYP1A|CMYP1B|KDS|MHS|MHS1|PPP1R137|RYDR|RYR|RYR-1|RYR1|SKRR
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- This gene encodes a ryanodine receptor found in skeletal muscle. The encoded protein functions as a calcium release channel in the sarcoplasmic reticulum but also serves to connect the sarcoplasmic reticulum and transverse tubule. Mutations in this gene are associated with malignant hyperthermia susceptibility, central core disease, and minicore myopathy with external ophthalmoplegia. Alternatively spliced transcripts encoding different isoforms have been described.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 565kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- KFLPPPGYAPCHEAVLPRERLHLEPIKEYRREGPRGPHLVGPSRCLSHTDFVPCPVDTVQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDDNK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A23056
