CD103 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A23053-20UL
100 ul
£336.00
A23053-100UL
500 ul
£1258.00
A23053-500UL
1000 ul
£2228.00
A23053-1000UL
About this Product
- SKU:
- A23053
- Additional Names:
- A530055J10|alpha-E1|alpha-M290|aM290|CD103
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Predicted to enable metal ion binding activity. Predicted to act upstream of or within cell adhesion and integrin-mediated signaling pathway. Located in external side of plasma membrane. Is expressed in several structures, including alimentary system; genitourinary system; lymph node; nasal septum; and nucleus pulposus. Orthologous to human ITGAE (integrin subunit alpha E).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 150kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- EDGTEIAIVLDGSGSIEPSDFQKAKNFISTMMRNFYEKCFECNFALVQYGAVIQTEFDLQESRDINASLAKVQSIVQVKEVTKTASAMQHVLDNIFIPSRGSRKKALKVMVVLTDGDIFGDPLNLTTVINSPKMQGVVRFAIGVGDAFKNNNTYRELKLIASDPKEAHTFKVTNYSALDGLLSKLQQHIVHMEGT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A23053
