CD47 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A23052-20UL
100 ul
£336.00
A23052-100UL
500 ul
£1258.00
A23052-500UL
1000 ul
£2228.00
A23052-1000UL
About this Product
- SKU:
- A23052
- Additional Names:
- 9130415E20Rik|B430305P08Rik|CD47|IAP|Itgp
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Predicted to enable protein binding activity involved in heterotypic cell-cell adhesion and thrombospondin receptor activity. Involved in regulation of nitric oxide biosynthetic process. Acts upstream of or within several processes, including monocyte aggregation; opsonization; and positive regulation of phagocytosis. Located in extracellular exosome. Is integral component of plasma membrane. Is expressed in several structures, including alimentary system; central nervous system; genitourinary system; hemolymphoid system gland; and liver and biliary system. Orthologous to human CD47 (CD47 molecule).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 45-60kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse, Rat
- Sequence:
- QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTAFNT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A23052
