Yipf6 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A22875-20UL
100 ul
£336.00
A22875-100UL
500 ul
£1258.00
A22875-500UL
1000 ul
£2228.00
A22875-1000UL
About this Product
- SKU:
- A22875
- Additional Names:
- A430107J06Rik|Yipf6
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Enables identical protein binding activity. Acts upstream of or within intestinal epithelial cell development. Located in COPII-coated ER to Golgi transport vesicle; cis-Golgi network; and trans-Golgi network. Orthologous to human YIPF6 (Yip1 domain family member 6).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 26kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse, Rat
- Sequence:
- MAEAEDSPGEQEAAASKPLFAGLSDVSISQDIPIEGEITIPSRARAQEHDSSTLNESIRRTIMRDLKAVGRKFMHVLYPRKSN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A22875
