ABflo[R] 488 Rabbit anti-Mouse Ly-6A/E (Sca-1) monoclonal antibody
Product Sizes
10 tests
£ POA
A22786-10TESTS
100 tests
£259.00
A22786-100TESTS
200 tests
£390.00
A22786-200TESTS
500 tests
£592.00
A22786-500TESTS
About this Product
- SKU:
- A22786
- Additional Names:
- Ly-6A.2|Ly-6A/E|Ly-6E.1|Sca-1|Sca1|TAP
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 488
- Extra Details:
- Predicted to enable acetylcholine receptor binding activity and acetylcholine receptor inhibitor activity. Acts upstream of or within response to bacterium. Located in external side of plasma membrane. Is expressed in alimentary system; hindlimb tendon; liver; metanephros; and physiological umbilical hernia. Used to study osteoporosis. Orthologous to human LY6H (lymphocyte antigen 6 family member H).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- Refer to figures
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- LECYQCYGVPFETSCPSITCPYPDGVCVTQEAAVIVDSQTRKVKNNLCLPICPPNIESMEILGTKVNVKTSCCQEDLCNVAVPNG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A22786
