RELA Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A22676-20UL
100 ul
£336.00
A22676-100UL
500 ul
£1258.00
A22676-500UL
1000 ul
£2228.00
A22676-1000UL
About this Product
- SKU:
- A22676
- Additional Names:
- p65|p65 NF-kappa B|p65 NFkB|RELA
- Application:
- ELISA, Immunocytochemistry, Immunofluorescence, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Enables several functions, including DNA-binding transcription factor activity, RNA polymerase II-specific; actinin binding activity; and ankyrin repeat binding activity. Involved in several processes, including negative regulation of protein sumoylation; postsynapse to nucleus signaling pathway; and regulation of transcription, DNA-templated. Acts upstream of or within several processes, including cellular response to hepatocyte growth factor stimulus; cellular response to lipopolysaccharide; and positive regulation of interleukin-12 production. Located in several cellular components, including chromatin; cytosol; and glutamatergic synapse. Is expressed in several structures, including alimentary system; early conceptus; genitourinary system; musculature; and skin. Human ortholog(s) of this gene implicated in ductal carcinoma in situ; lung non-small cell carcinoma; lymphoma; and renal cell carcinoma. Orthologous to human RELA (RELA proto-oncogene, NF-kB subunit).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 65kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Sequence:
- PLAQPPAPAPVLTPGPPQSLSAPVPKSTQAGEGTLSEALLHLQFDADEDLGALLGNSTDPGVFTDLASVDNSEFQQLLNQGVSMSHSTAEPMLMEYPEAIT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A22676
