BCL6 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A22610-5UL
20 ul
£164.00
A22610-20UL
100 ul
£342.00
A22610-100UL
500 ul
£1532.00
A22610-500UL
1000 ul
£2704.00
A22610-1000UL
About this Product
- SKU:
- A22610
- Additional Names:
- BCL5|BCL6|BCL6A|LAZ3|ZBTB27|ZNF51
- Application:
- ELISA, Flow Cytometry
- Clonality:
- Monoclonal
- Extra Details:
- The protein encoded by this gene is a zinc finger transcription factor and contains an N-terminal POZ domain. This protein acts as a sequence-specific repressor of transcription, and has been shown to modulate the transcription of STAT-dependent IL-4 responses of B cells. This protein can interact with a variety of POZ-containing proteins that function as transcription corepressors. This gene is found to be frequently translocated and hypermutated in diffuse large-cell lymphoma (DLCL), and may be involved in the pathogenesis of DLCL. Alternatively spliced transcript variants encoding different protein isoforms have been found for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- Refer to figures
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- PKERALPCDSARPVPGEYSRPTLEVSPNVCHSNIYSPKETIPEEARSDMHYSVAEGLKPAAPSARNAPYFPCDKASKEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSSKNACILQASG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A22610
