ABflo[R] 647 Rabbit anti-Dog CD27 monoclonal antibody
Product Sizes
10 tests
£ POA
A22576-10TESTS
100 tests
£324.00
A22576-100TESTS
200 tests
£509.00
A22576-200TESTS
500 tests
£782.00
A22576-500TESTS
About this Product
- SKU:
- A22576
- Additional Names:
- S152|S152. LPFS2|T14|TNFRSF7|Tp55
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 647
- Extra Details:
- The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is required for generation and long-term maintenance of T cell immunity. It binds to ligand CD70, and plays a key role in regulating B-cell activation and immunoglobulin synthesis. This receptor transduces signals that lead to the activation of NF-kappaB and MAPK8/JNK. Adaptor proteins TRAF2 and TRAF5 have been shown to mediate the signaling process of this receptor. CD27-binding protein (SIVA), a proapoptotic protein, can bind to this receptor and is thought to play an important role in the apoptosis induced by this receptor.
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 31kDa
- Purification:
- Affinity Purified
- Reactivities:
- Canine
- Sequence:
- ATPAPKRCPEKHYQVQGERCCQMCKPGTFLVKDCERHGEAAQCDPCIPGASFSPDHHARRHCESCRHCNSGLLIRNCTLTANAECDCPKGWKCRDKQCTECDPPSNPLLIPHPSPARGPHLQPTHLPYAKIKFQATLCPVTGIVRLSPQSPPSPKMQETSTVRQVQTLADFRWLPAPALSTHWPPQRSLCSSDCIR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A22576
