[KO Validated] MCU Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A22525-5UL
20 ul
£164.00
A22525-20UL
100 ul
£342.00
A22525-100UL
500 ul
£1532.00
A22525-500UL
1000 ul
£2704.00
A22525-1000UL
About this Product
- SKU:
- A22525
- Additional Names:
- C10orf42|CCDC109A|CU|HsMCU
- Application:
- ELISA, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- Enables calcium channel activity; identical protein binding activity; and uniporter activity. Involved in several processes, including positive regulation of mitochondrial calcium ion concentration; positive regulation of mitochondrial fission; and positive regulation of neutrophil chemotaxis. Acts upstream of or within calcium import into the mitochondrion. Located in mitochondrial inner membrane. Is integral component of mitochondrial inner membrane. Part of uniplex complex.
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 35kda
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- VHQRIASWQNLGAVYCSTVVPSDDVTVVYQNGLPVISVRLPSRRERCQFTLKPISDSVGVFLRQLQEEDRGIDRVAIYSPDGVRVAASTGIDLLLLDDFKLVINDLTYHVRPPKRDLLSH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A22525
