PI3 Kinase p85 alpha/beta Rabbit monoclonal antibody
Product Sizes
20 ul
£164.00
A22487-20UL
100 ul
£342.00
A22487-100UL
About this Product
- SKU:
- A22487
- Additional Names:
- PI3 Kinase p85 alpha/beta|PIK3R1/PIK3R2
- Application:
- ELISA, Western Blot
- Clonality:
- Monoclonal
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 42-54 kDa/81-84 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Sequence:
- SVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCQT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A22487
