[KO Validated] NF-kB p65/RelA Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A22331-5UL
20 ul
£164.00
A22331-20UL
100 ul
£342.00
A22331-100UL
500 ul
£1532.00
A22331-500UL
1000 ul
£2704.00
A22331-1000UL
About this Product
- SKU:
- A22331
- Additional Names:
- AIF3BL3|CMCU|lA|NFKB3|p65
- Application:
- ChIP, ELISA, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- NF-kappa-B is a ubiquitous transcription factor involved in several biological processes. It is held in the cytoplasm in an inactive state by specific inhibitors. Upon degradation of the inhibitor, NF-kappa-B moves to the nucleus and activates transcription of specific genes. NF-kappa-B is composed of NFKB1 or NFKB2 bound to either REL, RELA, or RELB. The most abundant form of NF-kappa-B is NFKB1 complexed with the product of this gene, RELA. Four transcript variants encoding different isoforms have been found for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 65kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Non-human Primate, Rat
- Sequence:
- LGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A22331
