ABflo[R] 488 Rabbit anti-Human CD225/IFITM1 monoclonal antibody
Product Sizes
10 tests
£ POA
A22310-10TESTS
100 tests
£259.00
A22310-100TESTS
200 tests
£390.00
A22310-200TESTS
500 tests
£592.00
A22310-500TESTS
About this Product
- SKU:
- A22310
- Additional Names:
- 9-27|CD225|DSPA2a|IFI17|LEU13
- Application:
- Flow Cytometry, Immunocytochemistry, Immunofluorescence
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 488
- Extra Details:
- Interferon-induced transmembrane (IFITM) proteins are a family of interferon induced antiviral proteins. The family contains five members, including IFITM1, IFITM2 and IFITM3 that belong to the CD225 superfamily. The protein encoded by this gene restricts cellular entry by diverse viral pathogens, such as influenza A virus, Ebola virus and Sars-CoV-2.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 14kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- MHKEEHEVAVLGPPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYAS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A22310
