IL4 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A22284-5UL
20 ul
£164.00
A22284-20UL
100 ul
£342.00
A22284-100UL
500 ul
£1532.00
A22284-500UL
1000 ul
£2704.00
A22284-1000UL
About this Product
- SKU:
- A22284
- Additional Names:
- BSF-1|Il-4|IL4
- Application:
- ELISA, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- Enables cytokine activity. Involved in several processes, including innate immune response in mucosa; negative regulation of white fat cell proliferation; and regulation of gene expression. Acts upstream of or within several processes, including T-helper cell differentiation; positive regulation of macromolecule metabolic process; and regulation of leukocyte activation. Located in external side of plasma membrane and extracellular space. Is expressed in several structures, including brain; colon; hemolymphoid system; liver; and placenta. Used to study Sjogren's syndrome; atopic dermatitis; and type 1 diabetes mellitus. Human ortholog(s) of this gene implicated in several diseases, including asthma (multiple); autoimmune disease (multiple); hepatitis B; hepatitis C; and pancreatic cancer (multiple). Orthologous to human IL4 (interleukin 4).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 16kDa/18kDa (Recombinant Protein)
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A22284
