S100A7/Psoriasin Rabbit monoclonal antibody
Product Sizes
20 ul
£164.00
A22271-20UL
100 ul
£342.00
A22271-100UL
About this Product
- SKU:
- A22271
- Additional Names:
- PSOR1|S100A7/Psoriasin|S100A7c
- Application:
- ELISA, IHC-Paraffin, Western Blot
- Clonality:
- Monoclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 2-101 of human S100A7/Psoriasin (NP_002954.2).
- Isotype:
- IgG
- Molecular Weight:
- 11 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- SNTQAERSIIGMIDMFHKYTRRDDKIEKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A22271
