APRR3 Rabbit polyclonal antibody
Product Sizes
5 ul
£ POA
A22254-5UL
20 ul
£164.00
A22254-20UL
100 ul
£342.00
A22254-100UL
500 ul
£1532.00
A22254-500UL
1000 ul
£2704.00
A22254-1000UL
About this Product
- SKU:
- A22254
- Additional Names:
- APRR3|MGO3_8|MGO3.8|pseudo-response regulator 3
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Encodes pseudo-response regulator 3 (APRR3/PRR3). PRR3 transcript levels vary in a circadian pattern with peak expression at dusk under long and short day conditions. PRR3 affects the period of the circadian clock and seedlings with reduced levels of PRR3 have shorter periods, based on transcriptional assays of clock-regulated genes. PRR3 is expressed in the vasculature of cotyledons and leaves where it may help stabilize the TOC1 protein by preventing interactions between TOC1 and the F-box protein ZTL.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 55kDa
- Purification:
- Affinity Purified
- Reactivities:
- Plant
- Sequence:
- TQSSWTKRASDTKSTSPSNQFPDAPNKKGTYENGCAHVNRLKEAEDQKEQIGTGSQTGMSMSKKAEEPGDLEKNAKYSVQALERNNDDTLNRSSGNSQVESKAPSSNREDLQSLEQTLKKTREDRDY
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A22254
