ABF3 Rabbit polyclonal antibody
Product Sizes
20 ul
£164.00
A22251-20UL
100 ul
£342.00
A22251-100UL
About this Product
- SKU:
- A22251
- Additional Names:
- ABF3|abscisic acid responsive elements-binding factor 3|AtABF3|DC3 PROMOTER-BINDING FACTOR 5|DPBF5|F17I5.200
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Plant
- Sequence:
- QQPQQLIQTQERPFPKQTTIAFSNTVDVVNRSQPATQCQEVKPSILGIHNHPMNNNLLQAVDFKTGVTVAAVSPGSQMSPDLTPKSALDASLSPVPYMFGR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A22251
