UPK3B Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A22120-20UL
100 ul
£336.00
A22120-100UL
500 ul
£1258.00
A22120-500UL
1000 ul
£2228.00
A22120-1000UL
About this Product
- SKU:
- A22120
- Additional Names:
- P35|UP3B|UPIIIB|UPK3B
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- UPK3B is a minor component of the apical plaques of mammalian urothelium that binds and dimerizes with uroplakin-1b (UPK1B; MIM 602380), one of the major conserved urothelium membrane proteins. The other major conserved integral membrane proteins of urothelial plaques are UPK1A (MIM 611557), UPK2 (MIM 611558), and UPK3A (MIM 611559) (Deng et al., 2002 [PubMed 12446744]).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 34kda
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- RLGEAAPGTPTPVSVAHLLSPVATELVPYTPQITAWDLEGKVTATTFSLEQPRCVFDGLASASDTVWLVVAFSNASRGFQNPETLADIPASPQLLTDGHYMTLPLSPDQLPCGDPMAGSGGAPVLRVGHDHGCHQQPFCNA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A22120
