Ataxin-3 (ATXN3) Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A22094-5UL
20 ul
£164.00
A22094-20UL
100 ul
£342.00
A22094-100UL
500 ul
£1532.00
A22094-500UL
1000 ul
£2704.00
A22094-1000UL
About this Product
- SKU:
- A22094
- Additional Names:
- AT3|Ataxin-3 (ATXN3)|ATX3|JOS|MJD|MJD1|SCA3
- Application:
- ELISA, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- Machado-Joseph disease, also known as spinocerebellar ataxia-3, is an autosomal dominant neurologic disorder. The protein encoded by this gene contains (CAG)n repeats in the coding region, and the expansion of these repeats from the normal 12-44 to 52-86 is one cause of Machado-Joseph disease. There is a negative correlation between the age of onset and CAG repeat numbers. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 42kda
- Purification:
- Affinity Purified
- Reactivities:
- Mouse, Rat
- Sequence:
- KLIGEELAQLKEQRVHKTDLERVLEANDGSGMLDEDEEDLQRALALSRQEIDMEDEEADLRRAIQLSMQGSSRNISQDMTQTSGTNLTSEELRKRREAYFEKQQQKQQQQQQQQQQGDLSGQSSHPCERPATSSGALGSDLGDAMSEEDMLQAAVTMSLETVRNDLKTEGKK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A22094
