DRP1 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A21968-5UL
20 ul
£164.00
A21968-20UL
100 ul
£342.00
A21968-100UL
500 ul
£1532.00
A21968-500UL
1000 ul
£2704.00
A21968-1000UL
About this Product
- SKU:
- A21968
- Additional Names:
- DLP1|DRP1|DVLP|DYMPLE|EMPF|EMPF1|HDYNIV|OPA5
- Application:
- ELISA, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- This gene encodes a member of the dynamin superfamily of GTPases. The encoded protein mediates mitochondrial and peroxisomal division, and is involved in developmentally regulated apoptosis and programmed necrosis. Dysfunction of this gene is implicated in several neurological disorders, including Alzheimer's disease. Mutations in this gene are associated with the autosomal dominant disorder, encephalopathy, lethal, due to defective mitochondrial and peroxisomal fission (EMPF). Alternative splicing results in multiple transcript variants encoding different isoforms.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 78kDa/82kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Non-human Primate, Rat
- Sequence:
- QDSRRETKNVASGGGGVGDGVQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAV
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A21968
