KBTBD3 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A2152-20UL
100 ul
£336.00
A2152-100UL
500 ul
£1258.00
A2152-500UL
1000 ul
£2228.00
A2152-1000UL
About this Product
- SKU:
- A2152
- Additional Names:
- 2200003A07Rik|Bklhd3|KBTBD3
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Is expressed in several structures, including central nervous system; dorsal root ganglion; early conceptus; genitourinary system; and tooth. Orthologous to human KBTBD3 (kelch repeat and BTB domain containing 3).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 69kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- GSQDIKSLLDVESYNPLSREWTSVSPLPRGIYYPEASACQNIIYVLGSEVEIADAFNPSLDCFFKYNATTDQWSELVAEFGQFFHATLIKAVPVNCTLYICDLSTYKVYSFCPDTCVWKGEGSFECAGFNAGAIGIEDKIYILGGDYAPDEITDEVQVYHSSRSEWEEVSPMPRALTEFYCQVIQFNKYRDPWYSNHF
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A2152
