PIWIL1 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A2150-20UL
100 ul
£336.00
A2150-100UL
500 ul
£1258.00
A2150-500UL
1000 ul
£2228.00
A2150-1000UL
About this Product
- SKU:
- A2150
- Additional Names:
- MIWI|PIWIL1
- Application:
- ELISA, IHC-Paraffin, Immunofluorescence, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Enables several functions, including RNA binding activity; mRNA cap binding complex binding activity; and polysome binding activity. Involved in negative regulation of transposition; piRNA metabolic process; and spermatogenesis, exchange of chromosomal proteins. Located in chromatoid body; dense body; and nucleus. Is expressed in genitourinary system. Orthologous to human PIWIL1 (piwi like RNA-mediated gene silencing 1).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 90kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- MTGRARARARGRARGQETVQHVGAAASQQPGYIPPRPQQSPTEGDLVGRGRQRGMVVGATSKSQELQISAGFQELSLAERGGRRRDFHDLGVNTRQNLDHVKESKTGSSGIIVKLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A2150
