TIFY11B Rabbit polyclonal antibody
Product Sizes
20 ul
£164.00
A21305-20UL
100 ul
£342.00
A21305-100UL
About this Product
- SKU:
- A21305
- Additional Names:
- jasmonate-zim-domain protein 6|T10D10_8|T10D10.8|TIFY DOMAIN PROTEIN 11B|TIFY11B
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 30kDa
- Purification:
- Affinity Purified
- Reactivities:
- Plant
- Sequence:
- NNEDQETGQQHQVVERIARRASLHRFFAKRKDRAVARAPYQVNQHGSHLPPKPEMVAPSIKSGQSSQHIATPPKPKAHNHMPMEVDKKEGQSSKNLELKL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A21305
