COR28 Rabbit polyclonal antibody
Product Sizes
5 ul
£ POA
A21278-5UL
20 ul
£164.00
A21278-20UL
100 ul
£342.00
A21278-100UL
500 ul
£1532.00
A21278-500UL
1000 ul
£2704.00
A21278-1000UL
About this Product
- SKU:
- A21278
- Additional Names:
- COR28|F17I5_170|F17I5.170
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Light and temperature are two key environmental signals that profoundly affect plant growth and development, COR28 and COR27 are negative regulators of freezing tolerance but positive regulators of flowering. They are involved in central circadian clock regulation and in flowering promotion, by binding to the chromatin of clock-associated evening genes TOC1, PRR5, ELF4 and cold-responsive genes in order to repress their transcription. And also are direct targets of CCA1, which represses their transcription via chromatin binding.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 30kDa
- Purification:
- Affinity Purified
- Reactivities:
- Plant
- Sequence:
- SKLDECTAWTNEKHNSYLDYLESSFVRQLYSLLGGGTQRLSRTRDVQSNSHKSADQFTVLQNGCWQKVNFGKKQSCLETSSEFRFHRNSLRNKPENSNGNYTMGTTVQGDVLCHDETKHSE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A21278
