LIN28A Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A21261-5UL
20 ul
£164.00
A21261-20UL
100 ul
£342.00
A21261-100UL
500 ul
£1532.00
A21261-500UL
1000 ul
£2704.00
A21261-1000UL
About this Product
- SKU:
- A21261
- Additional Names:
- CSDD1|LIN-28|lin-28A|LIN28|LIN28A|ZCCHC1
- Application:
- ELISA, Immunocytochemistry, Immunofluorescence, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- This gene encodes a LIN-28 family RNA-binding protein that acts as a posttranscriptional regulator of genes involved in developmental timing and self-renewal in embryonic stem cells. The encoded protein functions through direct interaction with target mRNAs and by disrupting the maturation of certain miRNAs involved in embryonic development. This protein prevents the terminal processing of the LET7 family of microRNAs which are major regulators of cellular growth and differentiation. Aberrant expression of this gene is associated with cancer progression in multiple tissues.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 28 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- SAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A21261
