Semaphorin 4D / CD100 Rabbit monoclonal antibody
Product Sizes
20 ul
£164.00
A21070-20UL
100 ul
£342.00
A21070-100UL
About this Product
- SKU:
- A21070
- Additional Names:
- A8|BB18|C9orf164|CD100|coll-4|COLL4|GR3|M-sema-G|SEMAJ|Semaphorin 4D / CD100
- Application:
- ELISA, IHC-Paraffin, Western Blot
- Clonality:
- Monoclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 96kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- KGKSKQTECLNYIRVLQPLSATSLYVCGTNAFQPACDHLNLTSFKFLGKNEDGKGRCPFDPAHSYTSVMVDGELYSGTSYNFLGSEPIISRNSSHSPLRTE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A21070
