Nup107 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A20955-5UL
20 ul
£164.00
A20955-20UL
100 ul
£342.00
A20955-100UL
500 ul
£1532.00
A20955-500UL
1000 ul
£2704.00
A20955-1000UL
About this Product
- SKU:
- A20955
- Additional Names:
- GAMOS7|NPHS11|Nup107|NUP84|ODG6
- Application:
- ELISA, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- This gene encodes a member of the nucleoporin family. The protein is localized to the nuclear rim and is an essential component of the nuclear pore complex (NPC). All molecules entering or leaving the nucleus either diffuse through or are actively transported by the NPC. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 106 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- LASKKHEAAKEVFVKIPQDSIAEIYNQCEEQGMESPLPAEDDNAIREHLCIRAYLEAHETFNEWFKHMNSVPQKPALIPQPTFTEKVAHEHKEKKYEMDFG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A20955
