TRIM24 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A20938-5UL
20 ul
£164.00
A20938-20UL
100 ul
£342.00
A20938-100UL
500 ul
£1532.00
A20938-500UL
1000 ul
£2704.00
A20938-1000UL
About this Product
- SKU:
- A20938
- Additional Names:
- hTIF1|PTC6|RNF82|TF1A|TIF1|TIF1A|TIF1ALPHA|TRIM24
- Application:
- ELISA, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- The protein encoded by this gene mediates transcriptional control by interaction with the activation function 2 (AF2) region of several nuclear receptors, including the estrogen, retinoic acid, and vitamin D3 receptors. The protein localizes to nuclear bodies and is thought to associate with chromatin and heterochromatin-associated factors. The protein is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains - a RING, a B-box type 1 and a B-box type 2 - and a coiled-coil region. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 117kDa/140kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- TNNTIQFHCDPSFWAQNIINLGSLVIEDKESQPQMPKQNPVVEQNSQPPSGLSSNQLSKFPTQISLAQLRLQHMQQQVMAQRQQVQRRPAPVGLPNPRMQG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A20938
