TRAPPC2 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A20890-5UL
20 ul
£164.00
A20890-20UL
100 ul
£342.00
A20890-100UL
500 ul
£1532.00
A20890-500UL
1000 ul
£2704.00
A20890-1000UL
About this Product
- SKU:
- A20890
- Additional Names:
- hYP38334|MIP2A|SEDL|SEDT|TRAPPC2|TRAPPC2P1|TRS20|ZNF547L
- Application:
- ELISA, IHC-Paraffin, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- The protein encoded by this gene is thought to be part of a large multi-subunit complex involved in the targeting and fusion of endoplasmic reticulum-to-Golgi transport vesicles with their acceptor compartment. In addition, the encoded protein can bind c-myc promoter-binding protein 1 and block its transcriptional repression capability. Mutations in this gene are a cause of spondyloepiphyseal dysplasia tarda (SEDT). A processed pseudogene of this gene is located on chromosome 19, and other pseudogenes are found on chromosomes 8 and Y. Alternatively spliced transcript variants have been found for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 16 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- MSGSFYFVIVGHHDNPVFEMEFLPAGKAESKDDHRHLNQFIAHAALDLVDENMWLSNNMYLKTVDKFNEWFVSAFVTAGHMRFIMLHDIRQEDGIKNFFT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A20890
