AMSH Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A20889-5UL
20 ul
£164.00
A20889-20UL
100 ul
£342.00
A20889-100UL
500 ul
£1532.00
A20889-500UL
1000 ul
£2704.00
A20889-1000UL
About this Product
- SKU:
- A20889
- Additional Names:
- AMSH|MICCAP
- Application:
- ELISA, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- Cytokine-mediated signal transduction in the JAK-STAT cascade requires the involvement of adaptor molecules. One such signal-transducing adaptor molecule contains an SH3 domain that is required for induction of MYC and cell growth. The protein encoded by this gene binds to the SH3 domain of the signal-transducing adaptor molecule, and plays a critical role in cytokine-mediated signaling for MYC induction and cell cycle progression. Multiple alternatively spliced transcript variants encoding the same protein isoform have been found for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 50kda
- Purification:
- Affinity Purified
- Reactivities:
- Human, Non-human Primate
- Sequence:
- FPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A20889
