RSK2 / RPS6KA3 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A20868-5UL
20 ul
£164.00
A20868-20UL
100 ul
£342.00
A20868-100UL
500 ul
£1532.00
A20868-500UL
1000 ul
£2704.00
A20868-1000UL
About this Product
- SKU:
- A20868
- Additional Names:
- CLS|HU-3|ISPK-1|MAPKAPK1B|MRX19|p90-RSK2|pp90RSK2|RSK|RSK2|RSK2 / RPS6KA3|S6K-alpha3|XLID19
- Application:
- ELISA, IHC-Paraffin, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates various substrates, including members of the mitogen-activated kinase (MAPK) signalling pathway. The activity of this protein has been implicated in controlling cell growth and differentiation. Mutations in this gene have been associated with Coffin-Lowry syndrome (CLS).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 84kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- DIWSLGVLLYTMLTGYTPFANGPDDTPEEILARIGSGKFSLSGGYWNSVSDTAKDLVSKMLHVDPHQRLTAALVLRHPWIVHWDQLPQYQLNRQDAPHLVK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A20868
