P2Y12 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A20864-5UL
20 ul
£164.00
A20864-20UL
100 ul
£342.00
A20864-100UL
500 ul
£1532.00
A20864-500UL
1000 ul
£2704.00
A20864-1000UL
About this Product
- SKU:
- A20864
- Additional Names:
- 2900079B22Rik|4921504D23Rik|P2Y12
- Application:
- ELISA, Immunofluorescence, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- Enables G protein-coupled ADP receptor activity and G protein-coupled adenosine receptor activity. Involved in several processes, including cellular response to ATP; regulation of microglial cell migration; and substrate-dependent cell migration, cell extension. Acts upstream of or within several processes, including adenylate cyclase-modulating G protein-coupled receptor signaling pathway; platelet activation; and positive regulation of ion transport. Located in cell body membrane and cell projection membrane. Is expressed in central nervous system and cerebral cortex. Used to study platelet-type bleeding disorder 8. Human ortholog(s) of this gene implicated in asthma; cerebrovascular disease; peripheral artery disease; platelet-type bleeding disorder 8; and type 2 diabetes mellitus. Orthologous to human P2RY12 (purinergic receptor P2Y12).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 55kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse, Rat
- Sequence:
- FLGLITIDRYLKTTRPFKTSSPSNLLGAKILSVVIWAFMFLISLPNMILTNRRPKDKDVTKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYSLITKELYRSYVRTRGSAKVPKKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTRAVFDCSAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLTSMLRCSNSTSTSGTNKKKGQEGGEPSEETPM
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A20864
