Prdm9 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A20832-5UL
20 ul
£164.00
A20832-20UL
100 ul
£342.00
A20832-100UL
500 ul
£1532.00
A20832-500UL
1000 ul
£2704.00
A20832-1000UL
About this Product
- SKU:
- A20832
- Additional Names:
- Dsbc1|G1-419-29|Meisetz|Prdm9|PRDM9-B|Rcr1|repro7
- Application:
- Cell-based/Functional Assay, ELISA, IHC-Paraffin
- Clonality:
- Monoclonal
- Extra Details:
- Enables DNA binding activity; histone-lysine N-methyltransferase activity; and protein homodimerization activity. Involved in several processes, including gamete generation; histone lysine methylation; and meiosis I. Acts upstream of or within several processes, including histone methylation; positive regulation of meiotic nuclear division; and positive regulation of transcription by RNA polymerase II. Located in chromatin and nucleus. Is expressed in embryo and head. Orthologous to human PRDM9 (PR/SET domain 9).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- Refer to figures
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- DSEDSDEEWTPKQQVSPPWVPFRVKHSKQQKESSRMPFSGESNVKEGSGIENLLNTSGSEHVQKPVSSLEEGNTSGQHSGKKLKLRKKNVEVKMYRLRERKGLAYEEVSEPQDDDYLYCEKCQNFFIDSCPNHGPPLFVKDSMVDRGHPNHSVLSLPPGLRISPSGIPEAGLGVWNEASDLPVGLHFGPYEGQITEDEEAANSGYSWLITKGRNCYEYVDGQDESQANWMRYVNCARDDEEQNLVAFQYHRKIFYRTCRVIRPGCELLVWYGDEYGQELGIKWG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A20832
