Timm22 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A20813-20UL
100 ul
£336.00
A20813-100UL
500 ul
£1258.00
A20813-500UL
1000 ul
£2228.00
A20813-1000UL
About this Product
- SKU:
- A20813
- Additional Names:
- Tim22|Timm22
- Application:
- ELISA, Immunoprecipitation, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Predicted to enable mitochondrion targeting sequence binding activity and protein transmembrane transporter activity. Predicted to be involved in protein insertion into mitochondrial inner membrane. Predicted to act upstream of or within protein transport. Located in mitochondrion. Is expressed in several structures, including alimentary system; brain; cardiovascular system; egg cylinder; and genitourinary system. Human ortholog(s) of this gene implicated in combined oxidative phosphorylation deficiency 43. Orthologous to human TIMM22 (translocase of inner mitochondrial membrane 22).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 20kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- AEAPLQYSLLLQYLVGDKRQPRLLEPGSLGGIPSPAKSEEQKMIERAMESCAFKAVLACVGGFVLGGAFGIFTAGIDTNVGFDPKDPYRTPTAKEVLKDMGQR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A20813
