Somatostatin (SST) Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A20617-5UL
20 ul
£164.00
A20617-20UL
100 ul
£342.00
A20617-100UL
500 ul
£1532.00
A20617-500UL
1000 ul
£2704.00
A20617-1000UL
About this Product
- SKU:
- A20617
- Additional Names:
- SMST|Somatostatin (SST)|SST1
- Application:
- Detection/Quantitation, ELISA, IHC-Paraffin, Immunofluorescence, Immunohistochemistry
- Clonality:
- Monoclonal
- Extra Details:
- The hormone somatostatin has active 14 aa and 28 aa forms that are produced by alternate cleavage of the single preproprotein encoded by this gene. Somatostatin is expressed throughout the body and inhibits the release of numerous secondary hormones by binding to high-affinity G-protein-coupled somatostatin receptors. This hormone is an important regulator of the endocrine system through its interactions with pituitary growth hormone, thyroid stimulating hormone, and most hormones of the gastrointestinal tract. Somatostatin also affects rates of neurotransmission in the central nervous system and proliferation of both normal and tumorigenic cells.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- Refer to figures
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- TGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A20617
