HCoV-OC43 Spike S2 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A20616-20UL
100 ul
£336.00
A20616-100UL
500 ul
£1258.00
A20616-500UL
1000 ul
£2228.00
A20616-1000UL
About this Product
- SKU:
- A20616
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- S1 attaches the virion to the cell membrane by interacting with sialic acid-containing cell receptors, initiating the infection.; [Spike protein S1]: attaches the virion to the cell membrane by interacting with host receptor, initiating the infection.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 75kDa/145kDa
- Purification:
- Affinity Purified
- Reactivities:
- Virus
- Sequence:
- EPVGGLYEIQIPSEFTIGNMVEFIQTSSPKVTIDCAAFVCGDYAACKSQLVEYGSFCDNINAILTEVNELLDTTQLQVANSLMNGVTLSTKLKDGVNFNV
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A20616
