HCoV-OC43 Nucleoprotein Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A20610-20UL
100 ul
£336.00
A20610-100UL
500 ul
£1258.00
A20610-500UL
1000 ul
£2228.00
A20610-1000UL
About this Product
- SKU:
- A20610
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 50kda
- Purification:
- Affinity Purified
- Reactivities:
- Virus
- Sequence:
- YWYRHNRRSFKTADGNQRQLLPRWYFYYLGTGPHAKDQYGTDIDGVYWVASNQADVNTPADIVDRDPSSDEAIPTRFPPGTVLPQGYYIEGSGRSAPNSRS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A20610
