S100A8 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A20474-20UL
100 ul
£336.00
A20474-100UL
500 ul
£1258.00
A20474-500UL
1000 ul
£2228.00
A20474-1000UL
About this Product
- SKU:
- A20474
- Additional Names:
- 60B8Ag|B8Ag|Caga|CFAg|CP-10|MRP8|p8|S100A8
- Application:
- ELISA, IHC-Paraffin, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Predicted to enable calcium ion binding activity and calcium-dependent protein binding activity. Acts upstream of or within astrocyte development and positive regulation of peptide secretion. Predicted to be located in cytosol and intermediate filament cytoskeleton. Predicted to be active in extracellular space. Is expressed in several structures, including bone marrow; extraembryonic component; female reproductive system; and liver. Human ortholog(s) of this gene implicated in myocarditis. Orthologous to human S100A8 (S100 calcium binding protein A8).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 11kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse, Rat
- Sequence:
- MPSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A20474
