IL18 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A20473-20UL
100 ul
£336.00
A20473-100UL
500 ul
£1258.00
A20473-500UL
1000 ul
£2228.00
A20473-1000UL
About this Product
- SKU:
- A20473
- Additional Names:
- Igif|Il-18|IL18
- Application:
- ELISA, IHC-Paraffin, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Enables cytokine activity. Involved in lipid homeostasis; positive regulation of cell differentiation; and positive regulation of cold-induced thermogenesis. Acts upstream of or within several processes, including interleukin-18-mediated signaling pathway; positive regulation of NIK/NF-kappaB signaling; and positive regulation of interferon-gamma production. Located in extracellular space. Is expressed in several structures, including back skin; dorsal aorta; gut; lymphatic system; and reproductive system. Used to study atopic dermatitis. Human ortholog(s) of this gene implicated in several diseases, including Kawasaki disease; allergic rhinitis; autoimmune disease (multiple); biliary atresia; and hepatitis B. Orthologous to human IL18 (interleukin 18).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 22kDa/18kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- NFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A20473
