Slc39a11 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A20338-20UL
100 ul
£336.00
A20338-100UL
500 ul
£1258.00
A20338-500UL
1000 ul
£2228.00
A20338-1000UL
About this Product
- SKU:
- A20338
- Additional Names:
- 1810074D23Rik|Slc39a11|ZIP-11
- Application:
- ELISA, IHC-Paraffin, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Enables zinc ion transmembrane transporter activity. Predicted to be involved in zinc ion transmembrane transport. Predicted to act upstream of or within zinc ion transport. Located in Golgi apparatus; nucleus; and plasma membrane. Orthologous to human SLC39A11 (solute carrier family 39 member 11).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 35kda
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- HLGATEDPQTALALNLDPALMKKSDPRDPTSLLFPESELSIRIGSTGLLSDKRENGEVYQRKKVAATDLAEGVA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A20338
