Tspan18 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A20275-20UL
100 ul
£336.00
A20275-100UL
500 ul
£1258.00
A20275-500UL
1000 ul
£2228.00
A20275-1000UL
About this Product
- SKU:
- A20275
- Additional Names:
- 2610042G18Rik|6720430O15|Tspan18
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Predicted to be located in membrane. Predicted to be integral component of membrane. Predicted to be integral component of plasma membrane. Is expressed in several structures, including alimentary system; brain; genitourinary system; immune system; and integumental system. Orthologous to human TSPAN18 (tetraspanin 18).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 28kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse, Rat
- Sequence:
- GVNGPEDFKLASVFRLLTLDTEEVPKACCRREPQTRDGVVLSREECQLGRNPFINKQGCYTVILNTFETYVYLAGAFAIGVLAIELFLMVFAMCLFRGIQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A20275
