[KO Validated] Edf1 Rabbit polyclonal antibody
Product Sizes
5 ul
£ POA
A20274-5UL
20 ul
£164.00
A20274-20UL
100 ug
£342.00
A20274-100UG
500 ul
£1532.00
A20274-500UL
1000 ul
£2704.00
A20274-1000UL
About this Product
- SKU:
- A20274
- Additional Names:
- 0610008L11Rik|f1|MBF1
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Predicted to enable TFIID-class transcription factor complex binding activity and transcription coactivator activity. Predicted to be involved in positive regulation of DNA binding activity. Predicted to act upstream of or within cell differentiation. Predicted to be located in cytosol; nucleolus; and nucleoplasm. Predicted to be active in nucleus. Is expressed in several structures, including central nervous system; genitourinary system; heart; liver; and retina. Orthologous to human EDF1 (endothelial differentiation related factor 1).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 17kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Sequence:
- MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHHDRVTLEVGKVIQRGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPKAK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A20274
