STING/TMEM173 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A20175-20UL
100 ul
£336.00
A20175-100UL
500 ul
£1258.00
A20175-500UL
1000 ul
£2228.00
A20175-1000UL
About this Product
- SKU:
- A20175
- Additional Names:
- 2610307O08Rik|ERIS|Mita|MPYS|STING|STING-beta|Tmem173
- Application:
- ELISA, IHC-Paraffin, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Enables 2',3'-cyclic GMP-AMP binding activity; cyclic-di-GMP binding activity; and ubiquitin protein ligase binding activity. Involved in several processes, including defense response to other organism; macroautophagy; and positive regulation of interferon-beta production. Acts upstream of or within cellular response to interferon-beta; positive regulation of transcription by RNA polymerase II; and regulation of inflammatory response. Located in several cellular components, including autophagosome; perinuclear region of cytoplasm; and peroxisome. Is expressed in ductus deferens; epididymis; ileum; and prostate gland. Human ortholog(s) of this gene implicated in STING-associated vasculopathy with onset in infancy. Orthologous to human STING1 (stimulator of interferon response cGAMP interactor 1).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 33 kDa/35 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- SREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A20175
