STK33 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A19803-5UL
20 ul
£164.00
A19803-20UL
100 ul
£342.00
A19803-100UL
500 ul
£1532.00
A19803-500UL
1000 ul
£2704.00
A19803-1000UL
About this Product
- SKU:
- A19803
- Additional Names:
- STK33
- Application:
- ELISA, Immunocytochemistry, Immunofluorescence, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- Serine/threonine protein kinase (STK33) is a 524-residue kinase that belongs to the calcium/calmodulin-dependent family of kinases. STK33 exhibits differential expression in normal and malignant cancer tissue, including hepatocellular carcinoma. STK33 expression is required in the context of mutant KRAS, the most commonly mutated human oncogene, to maintain for cellular viability and proliferation. STK33 depletion via modulation of interacting proteins results in proteasome-mediated degradation of STK33 in human cancer cells, triggering apoptosis.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 58kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Sequence:
- KEWKNNPESVEENTTEEKNKPSTEEKLKSYQPWGNVPDANYTSDEEEEKQSTAYEKQFPATSKDNFDMCSSSFTSSKLLPAEIKGEMEKTPVTPSQGTATKYPAKSGALSRTKKKL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A19803
