ATAD2 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A19792-5UL
20 ul
£164.00
A19792-20UL
100 ul
£342.00
A19792-100UL
500 ul
£1532.00
A19792-500UL
1000 ul
£2704.00
A19792-1000UL
About this Product
- SKU:
- A19792
- Additional Names:
- ANCCA|ATAD2|CT137|PRO2000
- Application:
- ELISA, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- A large family of ATPases has been described, whose key feature is that they share a conserved region of about 220 amino acids that contains an ATP-binding site. The proteins that belong to this family either contain one or two AAA (ATPases Associated with diverse cellular Activities) domains. AAA family proteins often perform chaperone-like functions that assist in the assembly, operation, or disassembly of protein complexes. The protein encoded by this gene contains two AAA domains, as well as a bromodomain.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 180kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- MVVLRSSLELHNHSAASATGSLDLSSDFLSLEHIGRRRLRSAGAAQKKPAATTAKAGDGSSVKEVETYHRTRALRSLRKDAQNSSDSSFEKNVEITEQLA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A19792
