AIF1/IBA1 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A19776-5UL
20 ul
£169.00
A19776-20UL
100 ul
£360.00
A19776-100UL
500 ul
£1532.00
A19776-500UL
1000 ul
£2704.00
A19776-1000UL
About this Product
- SKU:
- A19776
- Additional Names:
- AIF-1|AIF1/IBA1|D17H6S50E|G1|Iba1
- Application:
- ELISA, IHC-Paraffin, Immunofluorescence, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- Enables actin filament binding activity and calcium ion binding activity. Involved in several processes, including Rac protein signal transduction; actin filament organization; and ruffle assembly. Acts upstream of or within actin filament bundle assembly. Located in several cellular components, including actin filament; phagocytic cup; and ruffle membrane. Is expressed in adrenal cortex; central nervous system; embryo mesenchyme; and retina. Human ortholog(s) of this gene implicated in type 1 diabetes mellitus. Orthologous to human AIF1 (allograft inflammatory factor 1).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 17kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- MSQSRDLQGGKAFGLLKAQQEERLEGINKQFLDDPKYSNDEDLPSKLEAFKVKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKRLIREVSSGSEET
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A19776
