Destrin Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A19772-5UL
20 ul
£164.00
A19772-20UL
100 ul
£342.00
A19772-100UL
500 ul
£1532.00
A19772-500UL
1000 ul
£2704.00
A19772-1000UL
About this Product
- SKU:
- A19772
- Additional Names:
- ACTDP|ADF|bA462D18.2|Destrin|HEL32
- Application:
- ELISA, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- The product of this gene belongs to the actin-binding proteins ADF family. This family of proteins is responsible for enhancing the turnover rate of actin in vivo. This gene encodes the actin depolymerizing protein that severs actin filaments (F-actin) and binds to actin monomers (G-actin). Two transcript variants encoding distinct isoforms have been identified for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 19kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEEGKEILVGDVGVTITDPFKHFVGMLPEKDCRYALYDASFETKESRKEELM
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A19772
