Proteinase 3/PR3 Rabbit monoclonal antibody
Product Sizes
20 ul
£164.00
A19748-20UL
100 ul
£342.00
A19748-100UL
About this Product
- SKU:
- A19748
- Additional Names:
- ACPA|AGP7|C-ANCA|CANCA|MBN|MBT|NP-4|NP4|P29|PR-3|PR3|Proteinase 3/PR3
- Application:
- ELISA, Immunofluorescence
- Clonality:
- Monoclonal
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 28kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- MAHRPPSPALASVLLALLLSGAARAAEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHF
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:A19748
